You will no longer have access to your Project Wedding account on or after March 30, 2017. Save any photos or information you'd like to keep and join WeddingWire for your all of your wedding planning needs today. Learn more »
Stationery, Real Weddings, Wedding Style, pink, Southern Real Weddings, Summer Weddings, Classic Real Weddings, Summer Real Weddings, Vineyard Real Weddings, Classic Weddings, Vineyard Weddings, Wedding invitations
1375618094 small thumb 1373747850 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086830016 low 1375618101 small thumb 1373747854 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0497 low 1376923271 small thumb 1375618124 1373747859 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9417 low 1375618106 small thumb 1373747857 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086740009 low 1375618107 small thumb 1373747858 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0102 low 1375618112 small thumb 1373747850 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9435 low 1375618125 small thumb 1373747858 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9572 low 1375618096 small thumb 1373747850 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0248 low 1375618125 small thumb 1373747859 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0669 low 1376924880 small thumb 1375618122 1373747857 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9599 low 1375618129 small thumb 1373747866 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0126 low 1375618135 small thumb 1373747867 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9425 low 1375618136 small thumb 1373747866 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086780006 low 1375618138 small thumb 1373747868 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086780007 low 1375618143 small thumb 1373747868 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086830001 low 1375618151 small thumb 1373747868 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086830003 low 1375618163 small thumb 1373747872 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086830004 low 1375618159 small thumb 1373747874 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086830005 low 1375618164 small thumb 1373747874 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086840007 low 1375618177 small thumb 1373746874 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086790005 low 1375618174 small thumb 1373747875 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086790008 low 1375618183 small thumb 1373747881 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086790012 low 1375618183 small thumb 1373747885 favinger favinger michael and carina photography virginiaweddingphotographersmichaelandcarinaphotography000086790010 low 1375618174 small thumb 1373747884 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0333 low 1375618188 small thumb 1373747884 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0650 low 1375618190 small thumb 1373747885 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0937 low 1375618195 small thumb 1373747884 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0335 low 1375618188 small thumb 1373747888 favinger favinger michael and carina photography keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0418 low
Last Updated: July 9, 2013 at 9:46 am

The Paper Goods • Julie and Tim's wedding stationery followed the day's elegant pink motif.   

Photo by Michael & Carina Photography

Log in or Sign up to post a comment
Chat About It