Stationery, Real Weddings, Wedding Style, pink, Southern Real Weddings, Summer Weddings, Classic Real Weddings, Summer Real Weddings, Vineyard Real Weddings, Classic Weddings, Vineyard Weddings, Wedding invitations
1375618094_small_thumb_1373747850_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086830016_low 1375618101_small_thumb_1373747854_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0497_low 1376923271_small_thumb_1375618124_1373747859_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9417_low 1375618106_small_thumb_1373747857_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086740009_low 1375618107_small_thumb_1373747858_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0102_low 1375618112_small_thumb_1373747850_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9435_low 1375618125_small_thumb_1373747858_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9572_low 1375618096_small_thumb_1373747850_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0248_low 1375618125_small_thumb_1373747859_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0669_low 1376924880_small_thumb_1375618122_1373747857_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9599_low 1375618129_small_thumb_1373747866_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0126_low 1375618135_small_thumb_1373747867_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography9425_low 1375618136_small_thumb_1373747866_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086780006_low 1375618138_small_thumb_1373747868_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086780007_low 1375618143_small_thumb_1373747868_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086830001_low 1375618151_small_thumb_1373747868_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086830003_low 1375618163_small_thumb_1373747872_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086830004_low 1375618159_small_thumb_1373747874_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086830005_low 1375618164_small_thumb_1373747874_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086840007_low 1375618177_small_thumb_1373746874_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086790005_low 1375618174_small_thumb_1373747875_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086790008_low 1375618183_small_thumb_1373747881_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086790012_low 1375618183_small_thumb_1373747885_favinger_favinger_michael_and_carina_photography_virginiaweddingphotographersmichaelandcarinaphotography000086790010_low 1375618174_small_thumb_1373747884_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0333_low 1375618188_small_thumb_1373747884_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0650_low 1375618190_small_thumb_1373747885_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0937_low 1375618195_small_thumb_1373747884_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0335_low 1375618188_small_thumb_1373747888_favinger_favinger_michael_and_carina_photography_keswickvineyardsvirginiaweddingphotographersmichaelandcarinaphotography0418_low
Last Updated: July 9, 2013 at 9:46 am

The Paper Goods • Julie and Tim's wedding stationery followed the day's elegant pink motif.   

Photo by Michael & Carina Photography

Log in or Sign up to post a comment
Chat About It